Buy IGF-1 LR3 1mg

€110.00

IGF-1 LR3 (Receptor Grade) is a long-acting analog of Insulin-like Growth Factor-1, engineered for enhanced stability and reduced binding to IGF-binding proteins. With extended half-life and high receptor affinity, it is widely utilized in advanced IGF-1R signaling, cell proliferation, and tissue research applications. Each vial is manufactured to ultra-high purity standards and verified with batch-specific COA for precision research use.

Technical Specifications

Peptide IGF-1 LR3 (Receptor Grade)
Full Name Insulin-like Growth Factor-1 Long Arginine 3
Length 83 AA (vs 70 AA native)
Modification Arginine substitution at position 3
N-Terminal MFPAMPLSSLFVN (13 AA extension)
Formula C₉₉₀H₁₅₂₈N₂₆₂O₃₀₄S₇
Mol. Weight ~9.1 kDa
Purity 99.98% (HPLC Verified)
Testing HPLC + ESI-MS
COA Yes (Batch-Specific)
Vial Size 1mg
Binding High IGF-1R / Reduced IGFBP (>100x)
Half-Life Several hours (extended)
Reconstitution Acetic Acid or Sterile Water (pH 3–4)
Storage -20°C (Dry); Aliquot after mixing
Stability 1–2 months (reconstituted, -20°C)
Applications IGF-1R, muscle, neuro & cell research
Dosage (In-Vitro) 1–100 ng/mL
Dosage (In-Vivo) 10–100 mcg/kg
Categories: , Tags: , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,

Description

The Gold Standard of IGF Research – IGF-1 LR3 (Receptor Grade) 1mg. Maximum Potency. Extended Half-Life. Uncompromised Purity.

 

Buy IGF-1 LR3 1mg Receptor Grade Europe, You have advanced beyond basic growth hormone research. You understand that IGF-1 (Insulin-like Growth Factor-1) is the primary mediator of anabolic and regenerative signaling. You know that native IGF-1 has a short half-life and binds to circulating binding proteins, limiting its bioavailability. Buy IGF-1 LR3 1mg Receptor Grade Europe

IGF-1 LR3 changes everything.

IGF-1 LR3 (Long Arginine 3) is a synthetic analog of human IGF-1 with two critical modifications: an arginine substitution at position 3 and a 13-amino acid N-terminal extension. These modifications reduce binding to IGF-binding proteins (IGFBPs), dramatically increasing free, bioactive IGF-1 with an extended half-life of several hours.

This is receptor grade. This is for serious researchers only.

Introducing the IGF-1 LR3 (Receptor Grade) 1mg Peptide from buypurepeptideseu.com – the most potent, long-acting IGF-1 analog available for European researchers. One milligram of lyophilized, receptor-grade peptide for advanced cell culture, tissue regeneration, and metabolic research. Buy IGF-1 LR3 1mg Receptor Grade Europe

Whether you are in Berlin studying muscle hypertrophy pathways, in Paris researching neuronal survival, or in Milan investigating cartilage repair, this peptide is your laboratory’s most powerful tool. We ship discreetly and securely to Albania, Andorra, Austria, Belgium, Bosnia, Bulgaria, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Moldova, Monaco, Montenegro, Netherlands, North Macedonia, Norway, Poland, Portugal, Romania, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland, Ukraine, Vatican City, and the United Kingdom.

When you need to buy peptides online Vienna, buy peptides Brussels, buy peptides online Milan, or figure out how can I buy peptides online Warsaw, we are your premium European supplier. And now, we offer the most advanced IGF-1 LR3 receptor grade peptide on the market. Buy IGF-1 LR3 1mg Receptor Grade Europe

What Is IGF-1 LR3? The Science of Potentiated IGF Signaling

Let us break down the molecular biology. IGF-1 is a 70-amino acid polypeptide that mediates many of the anabolic and regenerative effects of growth hormone. It activates the IGF-1 receptor (IGF-1R), a tyrosine kinase receptor that signals through the PI3K/Akt and MAPK/ERK pathways.

The problem with native IGF-1: Native IGF-1 has a short half-life (approximately 10-20 minutes) and binds with high affinity to IGF-binding proteins (IGFBPs) 1-6. More than 98% of circulating IGF-1 is bound to these binding proteins, making it unavailable for receptor activation.

The IGF-1 LR3 solution: IGF-1 LR3 has two key modifications that solve these problems:

  1. Arginine substitution at position 3 (R3): This substitution reduces binding affinity to IGFBPs by over 100-fold, resulting in dramatically increased free, bioactive IGF-1.

  2. 13-amino acid N-terminal extension (LR3): This extension increases the half-life from minutes to several hours, providing sustained receptor activation.

Receptor grade designation: Our IGF-1 LR3 is designated “receptor grade,” meaning it has been specifically validated for high-affinity IGF-1 receptor binding studies. This is the highest quality designation for IGF-1 research.

The Pure Peptides Shop advantage: Our IGF-1 LR3 (Receptor Grade) 1mg Peptide is manufactured under GMP peptide manufacturer EU standards. Each batch is third party tested with a Certificate of Analysis (COA) verifying 99.98% purity. We do not cut corners. We do not hide our lab testing transparency.

This is analytical grade IGF-1 LR3 Europe in lyophilized format. For researchers who need the most potent, bioavailable IGF-1 analog available, IGF-1 LR3 receptor grade is the essential tool.


Product Deep Dive: IGF-1 LR3 (Receptor Grade) 1mg Specifications

Peptide Name: IGF-1 LR3 (Long Arginine 3 IGF-1)
Full Name: Insulin-like Growth Factor-1 Long Arginine 3 (receptor grade)
Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids total, including 13-amino acid N-terminal extension)
Molecular Formula: C₉₉₀H₁₅₂₈N₂₆₂O₃₀₄S₇
Molecular Weight: Approximately 9,100 g/mol (9.1 kDa)
Purity Guarantee: 99.98% (HPLC verified, COA included)
Form: Lyophilized powder (white to off-white cake)
Reconstitution: Acetic acid 10mM or sterile water (do not use DMSO or alkaline solutions)
Storage (Lyophilized): -20°C (-4°F) for long-term storage; stable for 3 months at 4°C
Storage (Reconstituted): Aliquot and store at -20°C (-4°F); avoid freeze-thaw cycles

Key Modifications Compared to Native IGF-1:

Modification Native IGF-1 IGF-1 LR3 Effect
Position 3 amino acid Glutamic acid (E) Arginine (R) 100x reduced IGFBP binding
N-terminus Native sequence 13-amino acid extension (MFPAMPLSSLFVN) Extended half-life
Half-life ~10-20 minutes Several hours Sustained receptor activation
IGFBP affinity High Very low Increased bioavailability

Primary Research Applications:

  • IGF-1 receptor (IGF-1R) activation and signaling studies (PI3K/Akt, MAPK/ERK)

  • Muscle hypertrophy and protein synthesis research

  • Neuronal survival and neuroprotection studies

  • Cartilage and bone tissue regeneration research

  • Cell culture supplementation for proliferation studies

  • Wound healing and tissue repair models

  • Metabolic and glucose homeostasis research

  • Aging and longevity pathway studies

Mechanism of Action Summary:

Pathway Target Effect of IGF-1 LR3
IGF-1R Activation IGF-1 receptor tyrosine kinase Receptor autophosphorylation
PI3K/Akt Signaling Downstream of IGF-1R Cell survival, protein synthesis, glucose uptake
MAPK/ERK Signaling Downstream of IGF-1R Cell proliferation, differentiation
Protein Synthesis mTOR pathway Increased muscle protein synthesis
Glucose Metabolism GLUT4 translocation Increased glucose uptake

Why European Researchers Choose IGF-1 LR3 Receptor Grade 1mg

You are an advanced researcher studying IGF-1 signaling. You understand that native IGF-1 is rapidly bound by IGFBPs and cleared from circulation. You need a tool that provides sustained, bioavailable IGF-1 receptor activation.

The problem with native IGF-1 for research:

  • Short half-life (10-20 minutes) requires continuous infusion for sustained effect

  • High IGFBP binding (>98% bound) means most of the peptide is inactive

  • Difficult to achieve consistent receptor activation in vitro and in vivo

The IGF-1 LR3 advantage:

  • Extended half-life: Several hours vs minutes for native IGF-1

  • Reduced IGFBP binding: >100x reduction, dramatically increased free peptide

  • Receptor grade validated: Specifically tested for IGF-1R binding activity

  • Potent anabolic signaling: Enhanced PI3K/Akt and MAPK/ERK activation

What makes IGF-1 LR3 unique for research:

  • Muscle hypertrophy: Potent stimulator of protein synthesis via mTOR

  • Neuroprotection: Supports neuronal survival in injury and disease models

  • Tissue regeneration: Enhances cartilage, bone, and wound healing

  • Cell culture: Superior to native IGF-1 for proliferation studies

Who uses our IGF-1 LR3 (Receptor Grade) 1mg Peptide?

  • IGF-1 receptor signaling research institutions

  • Muscle biology and hypertrophy laboratories

  • Neuroscience and neuroprotection research centers

  • Cartilage, bone, and tissue regeneration studies

  • Cell culture and proliferation research

  • Metabolic and glucose homeostasis laboratories

  • Universities studying the most potent IGF-1 analog available


The European Logistics Advantage (Why We Convert)

You are a professional. You do not have time for customs delays or “where can I find a peptide shop in Albania” only to receive degraded, low-purity IGF-1 LR3. Our backend is designed for high-volume eCommerce and high-ticket researchers.

Speed: Orders placed before 14:00 CET ship same-day from our EU hub.

Discretion: Plain boxes. No “IGF-1 LR3” labels on outer packaging. Neutral customs declarations. Lyophilized vials are shipped with ice packs for stability.

Coverage: We specifically target buy peptides online Sarajevo, buy peptides online Skopje, buy peptides online Podgorica, buy peptides online Pristina, buy peptides online Tirana, buy peptides online Durrës, buy peptides online Vlorë, buy peptides online Andorra la Vella, buy peptides online Escaldes-Engordany, and buy peptides online Encamp with dedicated courier partners.

Trust Signals:

  • Secure payment via AES-256 encryption

  • Discreet delivery guaranteed

  • Third party tested peptides EU with COA included

  • ISO certified peptide supplier Europe standards

  • For research use only – full regulatory compliance

  • Receptor grade designation – highest quality IGF-1 LR3 available

Urgency Trigger: Our IGF-1 LR3 (Receptor Grade) 1mg Peptide is manufactured in extremely limited batches due to the complexity of 83-amino acid synthesis. Current stock for Central Europe is at 15% capacity. The next production run has a 8-10 week lead time. When it is gone, it is gone. Bulk deals available for institutional buyers.


FAQ: Your Questions & Answered

1. Q: What is the difference between IGF-1 LR3 and native IGF-1?
A: IGF-1 LR3 has two key modifications: an arginine substitution at position 3 that reduces binding to IGF-binding proteins (IGFBPs) by over 100-fold, and a 13-amino acid N-terminal extension that extends half-life from minutes to several hours. The result is dramatically increased bioavailability and sustained receptor activation compared to native IGF-1.

2. Q: What does “Receptor Grade” mean?
A: Receptor grade means the peptide has been specifically validated for high-affinity binding to the IGF-1 receptor (IGF-1R). This designation indicates the highest quality standard for IGF-1 research, ensuring consistent, reliable receptor activation studies.

3. Q: How does IGF-1 LR3 compare to growth hormone for research?
A: GH acts indirectly through IGF-1 production in the liver and peripheral tissues. IGF-1 LR3 acts directly on the IGF-1 receptor, bypassing the need for GH signaling. For studies requiring direct, potent IGF-1 receptor activation without the variability of GH-induced IGF-1 production, IGF-1 LR3 is the preferred tool.

4. Q: How should I reconstitute IGF-1 LR3?
A: Reconstitute in 10mM acetic acid or sterile water (pH 3-4). Do not use DMSO or alkaline solutions as they will degrade the peptide. Gently swirl – do not shake. After reconstitution, aliquot immediately and store at -20°C (-4°F) to prevent degradation from freeze-thaw cycles.

5. Q: How do I verify the 99.98% purity claim?
A: Every batch we ship has a unique Certificate of Analysis (COA) . You can scan the QR code on the box to see the HPLC chromatogram and mass spectrometry data. We are a third party tested peptides EU supplier with full lab testing transparency. This is How to Verify Peptide Purity & COA in practice.

6. Q: Do you ship to my specific city (e.g., Vienna, Austria)?
A: Absolutely. We ship to buy peptides Vienna, buy peptides Salzburg, buy peptides Graz, buy peptides Brussels, buy peptides Amsterdam, buy peptides Madrid, buy peptides Barcelona, buy peptides Rome, buy peptides Milan, buy peptides Naples, buy peptides Munich, buy peptides Berlin, buy peptides Hamburg, buy peptides Frankfurt, buy peptides Paris, buy peptides Lyon, buy peptides Marseille, buy peptides London, buy peptides Manchester, buy peptides Birmingham, and every major city in Europe.

7. Q: What is the difference between GMP and non-GMP peptides?
A: GMP peptide manufacturer EU standards are for pharmaceutical grade. Our IGF-1 LR3 is analytical grade (99.98%+), which exceeds many GMP standards for purity but is labeled “For Research Use Only” . The “Receptor Grade” designation is our internal highest quality standard for IGF-1 research.

8. Q: What is the recommended dosage for in vitro research?
A: For cell culture studies, typical concentrations range from 1-100 ng/mL. Start at 10 ng/mL and optimize based on your specific cell type and assay. For receptor binding studies, follow your validated protocol.

9. Q: How should I store IGF-1 LR3?
A: Lyophilized: Store at -20°C (-4°F) for long-term storage (up to 12 months). Stable for up to 3 months at 4°C (refrigerated). Reconstituted: Aliquot immediately and store at -20°C (-4°F). Avoid freeze-thaw cycles. Never store reconstituted IGF-1 LR3 at 4°C for extended periods.

10. Q: Does IGF-1 LR3 affect glucose metabolism?
A: Yes. IGF-1 LR3 activates the IGF-1 receptor, which signals through PI3K/Akt to promote GLUT4 translocation and glucose uptake. This is a well-documented effect and can be either a variable to control for or a specific research target for metabolic studies.

11. Q: Do you offer bulk pricing for institutions?
A: Yes. Visit buypurepeptideseu.com and contact our wholesale division. We supply bulk peptide supply Europe and wholesale research peptides EU for universities and laboratories. Bulk deals available for orders of 10+ vials.

12. Q: Is payment secure?
A: 100%. We use AES-256 encryption and accept secure cryptocurrencies and credit cards. Your privacy is our priority.

13. Q: How long does delivery take to Scandinavia?
A: To buy peptides Stockholm, buy peptides Oslo, buy peptides Copenhagen, or buy peptides Helsinki, delivery takes 3-5 business days. Lyophilized vials are shipped with ice packs for stability.

14. Q: What if my package is seized by customs?
A: Because we label our products for laboratory use only and ship from within Europe (no cross-continental customs checks for EU->EU), seizure rates are near zero. We are a trusted peptide suppliers Europe network.

15. Q: Do you sell to the UK post-Brexit?
A: Yes. We ship to buy peptides United Kingdom, specifically London, Manchester, Birmingham, Glasgow, Edinburgh, Bristol, Liverpool, Leeds, Sheffield, and Newcastle via Royal Mail tracked.

 

The difference between a wasted research cycle and a breakthrough in IGF-1 signaling is the quality of your reagents. Do not trust your IGF-1 research to a peptide supplier in Bulgaria that lacks a COA. Do not risk buying IGF-1 LR3 in Spain from a reseller who cannot verify receptor grade purity.  ...........................................

Go to the source. Go to the European leader in pure, certified, laboratory-grade IGF-1 LR3 receptor grade peptide.

One milligram of the most potent, long-acting IGF-1 analog available. 99.98% purity. Receptor grade validation. Extended half-life. Reduced IGFBP binding. Uncompromised quality.

Click below. Secure your vial. Advance your IGF-1 research.

[ORDER IGF-1 LR3 (RECEPTOR GRADE) 1mg NOW]
Visit: buypurepeptideseu.com

*For research use only, human consumption or therapeutic use. Must be 18+ to purchase. All products are for laboratory research purposes only. By ordering, you confirm you are a qualified researcher. IGF-1 LR3 (Receptor Grade) is for in vitro and authorized in vivo research only, specifically for studies involving IGF-1 receptor signaling, muscle hypertrophy, neuroprotection, and tissue regeneration.  . .  .  .  .  . .   .  .  . . . . . . . . . . . . . . . . . . . . . . . .  . . . . . . . .